Yinherb FOXO4-D-Retro-Inverso(DRI) Custom peptide Peptide Bulk powder
Name:FOXO4-D-Retro-Inverso(DRI) Custom peptide Senolytics Peptide
acetate (salt), Synthetic luteinizing hormone-releasing factor acetate
Appearance :White powder
Purity (HPLC) >98.0%
Single Impurity(HPLC) :1.0%max
Amino Acid Composition :±10% of theoretical
Peptide Content(N%) :≥80.0%
Water Content(Karl Fischer): ≤8.0%
Acetate Content(HPIC): ≤12.0%
MS(ESI): Consistent
Mass Balance: 95.0~105.0%
Bacterial Endotoxins :≤5EU/mg
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.
What is FOXO4-D-Retro-Inverso(DRI) Custom Peptide?
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
FOXO4-D-Retro-Inverso(DRI) HPLC &NMR Test report by Yinherb
Q1: Can i get some samples
A: Yes, we can supply the free sample, but the shipping cost be paid by our customers.
Q2: How to start orders or make payments
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information. Payment by T/T, Western Union or Paypal or Escrow(Alibaba).
Q3: How to confirm the Product Quality before placing orders
A:You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.
Q4:What's your MOQ
A:Our MOQ is 1kg. But usually we accept less quantity such as 100g on the condition that sample charge is 100% paid.
Q5: How about delivery leadtime
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)
Q6:Is there a discount
A:Different quantity has different discount.
Q7: How do you treat quality complaint
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.